PPIL2 Antikörper
-
- Target Alle PPIL2 Antikörper anzeigen
- PPIL2 (Peptidylprolyl Isomerase (Cyclophilin)-Like 2 (PPIL2))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPIL2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PPIL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GRVVGGFDVLTAMENVESDPKTDRPKEEIRIDATTVFVDPYEEADAQIAQ
- Top Product
- Discover our top product PPIL2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PPIL2 Blocking Peptide, catalog no. 33R-3545, is also available for use as a blocking control in assays to test for specificity of this PPIL2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPIL2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPIL2 (Peptidylprolyl Isomerase (Cyclophilin)-Like 2 (PPIL2))
- Andere Bezeichnung
- PPIL2 (PPIL2 Produkte)
- Synonyme
- cyc4 antikoerper, cyp60 antikoerper, hcyp-60 antikoerper, CYC4 antikoerper, CYP60 antikoerper, Cyp-60 antikoerper, UBOX7 antikoerper, hCyP-60 antikoerper, 0610009L05Rik antikoerper, 1700016N17Rik antikoerper, 4921520K19Rik antikoerper, 4930511F14Rik antikoerper, AA589416 antikoerper, C130078A06Rik antikoerper, si:dkeyp-86g2.1 antikoerper, zgc:56616 antikoerper, zgc:86735 antikoerper, peptidylprolyl isomerase like 2 S homeolog antikoerper, peptidylprolyl isomerase like 2 antikoerper, peptidylprolyl isomerase (cyclophilin)-like 2 antikoerper, ppil2.S antikoerper, PPIL2 antikoerper, ppil2 antikoerper, Ppil2 antikoerper
- Hintergrund
- PPIL2 is a member of the cyclophilin family of peptidylprolyl isomerases. The cyclophilins are a highly conserved ubiquitous family, members of which play an important role in protein folding, immunosuppression by cyclosporin A, and infection of HIV-1 virions.
- Molekulargewicht
- 59 kDa (MW of target protein)
-