Telefon:
+49 (0)241 95 163 153
Fax:
+49 (0)241 95 163 155
E-Mail:
orders@antikoerper-online.de

GAPDH Antikörper (Middle Region)

GAPDH Reaktivität: Human, Maus WB Wirt: Kaninchen Polyclonal unconjugated
Produktnummer ABIN630875
  • Target Alle GAPDH Antikörper anzeigen
    GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))
    Bindungsspezifität
    • 34
    • 22
    • 13
    • 11
    • 7
    • 6
    • 6
    • 5
    • 4
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    Middle Region
    Reaktivität
    • 213
    • 145
    • 138
    • 70
    • 64
    • 52
    • 36
    • 27
    • 22
    • 20
    • 19
    • 19
    • 17
    • 16
    • 11
    • 11
    • 11
    • 9
    • 9
    • 8
    • 4
    • 4
    • 4
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Human, Maus
    Wirt
    • 160
    • 94
    • 17
    • 11
    • 4
    Kaninchen
    Klonalität
    • 187
    • 97
    Polyklonal
    Konjugat
    • 154
    • 33
    • 18
    • 17
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    Dieser GAPDH Antikörper ist unkonjugiert
    Applikation
    • 229
    • 96
    • 71
    • 65
    • 43
    • 38
    • 30
    • 24
    • 16
    • 16
    • 15
    • 14
    • 7
    • 6
    • 5
    • 4
    • 4
    • 3
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Spezifität
    GAPDH antibody was raised against the middle region of GAPDH
    Aufreinigung
    Affinity purified
    Immunogen
    GAPDH antibody was raised using the middle region of GAPDH corresponding to a region with amino acids KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC
    Top Product
    Discover our top product GAPDH Primärantikörper
  • Applikationshinweise
    WB: 1 µg/mL
    Optimal conditions should be determined by the investigator.
    Kommentare

    GAPDH Blocking Peptide, catalog no. 33R-4239, is also available for use as a blocking control in assays to test for specificity of this GAPDH antibody

    Beschränkungen
    Nur für Forschungszwecke einsetzbar
  • Format
    Lyophilized
    Rekonstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAPDH antibody in PBS
    Konzentration
    Lot specific
    Buffer
    PBS
    Handhabung
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Lagerung
    4 °C/-20 °C
    Informationen zur Lagerung
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Kuroda, Ishii, Uematsu, Ohata, Coban, Akira, Aritake, Urade, Morimoto: "Silica crystals and aluminum salts regulate the production of prostaglandin in macrophages via NALP3 inflammasome-independent mechanisms." in: Immunity, Vol. 34, Issue 4, pp. 514-26, (2011) (PubMed).

    Shi, Zhang, Yang, Zhang, Wei: "ROCK1 plays an essential role in the transition from cardiac hypertrophy to failure in mice." in: Journal of molecular and cellular cardiology, Vol. 49, Issue 5, pp. 819-28, (2010) (PubMed).

    Matsumoto, Takahashi, Shiva, Kawanishi, Kremenik, Kato, Yano: "The reduction of voluntary physical activity after poly I:C injection is independent of the effect of poly I:C-induced interferon-beta in mice." in: Physiology & behavior, Vol. 93, Issue 4-5, pp. 835-41, (2008) (PubMed).

  • Target
    GAPDH (Glyceraldehyde-3-Phosphate Dehydrogenase (GAPDH))
    Andere Bezeichnung
    GAPDH (GAPDH Produkte)
    Synonyme
    G3PD antikoerper, GAPD antikoerper, Gapd antikoerper, BEST:GH12586 antikoerper, CG12055 antikoerper, Dmel\\CG12055 antikoerper, GA3PDH antikoerper, GADPH antikoerper, GAP antikoerper, GAPDH antikoerper, GAPDH I antikoerper, GAPDH-1 antikoerper, GAPDH1 antikoerper, GAPDHI antikoerper, Gapdh antikoerper, Gapdh-1 antikoerper, Gapdh43E antikoerper, gadph antikoerper, gapdh antikoerper, gapdh-1 antikoerper, gh12586 antikoerper, cb609 antikoerper, gapd antikoerper, mg:bb02e05 antikoerper, wu:fb33a10 antikoerper, wu:ft80f05 antikoerper, KNC-NDS6 antikoerper, g3pd antikoerper, G3PDH antikoerper, glyceraldehyde-3-phosphate dehydrogenase antikoerper, Glyceraldehyde 3 phosphate dehydrogenase 1 antikoerper, glyceraldehyde-3-phosphate dehydrogenase S homeolog antikoerper, glyceraldehyde-3-phosphate dehydrogenase, type I antikoerper, olfactory receptor 8K3 antikoerper, GAPDH antikoerper, Gapdh antikoerper, Gapdh1 antikoerper, gapdh antikoerper, gapdh.S antikoerper, gapDH antikoerper, LOC100404960 antikoerper, LOC614985 antikoerper
    Hintergrund
    GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD).
    Molekulargewicht
    36 kDa (MW of target protein)
Sie sind hier:
Kundenservice