GLE1 Antikörper

Produktnummer ABIN630876

Produktdetails anti-GLE1 Antikörper

Target: GLE1 (GLE1 RNA Export Mediator (GLE1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GLE1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GLE1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKLREAEQQRVKQAEQERLRKEEGQIRLRALYALQEEMLQLSQQLDASEQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GLE1 Blocking Peptide, catalog no. 33R-5089, is also available for use as a blocking control in assays to test for specificity of this GLE1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLE1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GLE1

Target: GLE1 (GLE1 RNA Export Mediator (GLE1))

Andere Bezeichnung: GLE1 (GLE1 Produkte)

Synonyme: Dmel\\CG14749 antikoerper, GLE1 antikoerper, GLE1L antikoerper, LCCS antikoerper, LCCS1 antikoerper, hGLE1 antikoerper, Gle1l antikoerper, 4933405K21Rik antikoerper, AA553313 antikoerper, CG14749 gene product from transcript CG14749-RA antikoerper, nucleoporin GLE1 antikoerper, RNA export factor Gle1 antikoerper, GLE1, RNA export mediator antikoerper, GLE1 RNA export mediator antikoerper, GLE1 RNA export mediator (yeast) antikoerper, CG14749 antikoerper, CpipJ_CPIJ014147 antikoerper, SJAG_03847 antikoerper, GLE1 antikoerper, Gle1 antikoerper

Hintergrund: GLE1 is a predicted 75 kDa polypeptide with high sequence and structure homology to yeast Gle1p, which is nuclear protein with a leucine-rich nuclear export sequence essential for poly(A)+RNA export. Inhibition of human GLE1L by microinjection of antibodies against GLE1L in HeLa cells resulted in inhibition of poly(A)+RNA export. Immunoflourescence studies show that GLE1L is localized at the nuclear pore complexes.

Molekulargewicht: 75 kDa (MW of target protein)