MEMO1 Antikörper (Middle Region)
-
- Target Alle MEMO1 Antikörper anzeigen
- MEMO1 (Mediator of Cell Motility 1 (MEMO1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MEMO1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MEMO1 antibody was raised against the middle region of MEMO1
- Aufreinigung
- Affinity purified
- Immunogen
- MEMO1 antibody was raised using the middle region of MEMO1 corresponding to a region with amino acids AMESHKDEFTIIPVLVGALSESKEQEFGKLFSKYLADPSNLFVVSSDFCH
- Top Product
- Discover our top product MEMO1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MEMO1 Blocking Peptide, catalog no. 33R-1386, is also available for use as a blocking control in assays to test for specificity of this MEMO1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MEMO1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MEMO1 (Mediator of Cell Motility 1 (MEMO1))
- Andere Bezeichnung
- MEMO1 (MEMO1 Produkte)
- Synonyme
- MGC89105 antikoerper, C2orf4 antikoerper, MEMO antikoerper, NS5ATP7 antikoerper, 0610016J10Rik antikoerper, D930048L02Rik antikoerper, RGD1309929 antikoerper, fi04d12 antikoerper, wu:fi04d12 antikoerper, zgc:55290 antikoerper, mediator of cell motility 1 antikoerper, mediator of cell motility 1 L homeolog antikoerper, MEMO1 antikoerper, memo1 antikoerper, Memo1 antikoerper, memo1.L antikoerper
- Hintergrund
- MEMO1 may control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. MEMO1 is the mediator of ERBB2 signaling. MEMO1 is required for breast carcinoma cell migration.
- Molekulargewicht
- 34 kDa (MW of target protein)
-