ACADVL Antikörper (N-Term)
-
- Target Alle ACADVL Antikörper anzeigen
- ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACADVL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ACADVL antibody was raised against the N terminal of ACADVL
- Aufreinigung
- Affinity purified
- Immunogen
- ACADVL antibody was raised using the N terminal of ACADVL corresponding to a region with amino acids RPYAGGAAQESKSFAVGMFKGQLTTDQVFPYPSVLNEEQTQFLKELVEPV
- Top Product
- Discover our top product ACADVL Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACADVL Blocking Peptide, catalog no. 33R-8111, is also available for use as a blocking control in assays to test for specificity of this ACADVL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADVL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))
- Andere Bezeichnung
- ACADVL (ACADVL Produkte)
- Hintergrund
- ACADVL is targeted to the inner mitochondrial membrane where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenase is specific to long-chain and very-long-chain fatty acids. A deficiency in ACADVL protein reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy.
- Molekulargewicht
- 64 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling, Monocarboxylic Acid Catabolic Process
-