EEF2 Antikörper (N-Term)

Produktnummer ABIN630891

Produktdetails anti-EEF2 Antikörper

Target: EEF2 (Eukaryotic Translation Elongation Factor 2 (EEF2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Drosophila melanogaster, C. elegans

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser EEF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: EEF2 antibody was raised against the N terminal of EEF2

Aufreinigung: Affinity purified

Immunogen: EEF2 antibody was raised using the N terminal of EEF2 corresponding to a region with amino acids TDSLVCKAGIIASARAGETRFTDTRKDEQERCITIKSTAISLFYELSEND

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

EEF2 Blocking Peptide, catalog no. 33R-9020, is also available for use as a blocking control in assays to test for specificity of this EEF2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EEF2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu EEF2

Target: EEF2 (Eukaryotic Translation Elongation Factor 2 (EEF2))

Andere Bezeichnung: EEF2 (EEF2 Produkte)

Synonyme: EEF-2 antikoerper, EF-2 antikoerper, EF2 antikoerper, Ef-2 antikoerper, eef2 antikoerper, MGC76191 antikoerper, MGC79628 antikoerper, EEF2 antikoerper, eef2l antikoerper, fe49h02 antikoerper, wu:fe49h02 antikoerper, zgc:63584 antikoerper, ef2 antikoerper, zef2 antikoerper, CG2238 antikoerper, Dmel\CG2238 antikoerper, EF-2b antikoerper, EF2B antikoerper, EF2b antikoerper, Ef2 antikoerper, Ef2B antikoerper, Ef2b antikoerper, anon-EST:Liang-1.44 antikoerper, chr2L:21668915..21669164 antikoerper, clone 1.44 antikoerper, eEF2 antikoerper, eF2 antikoerper, ef2b antikoerper, eukaryotic translation elongation factor 2 antikoerper, eukaryotic translation elongation factor 2, gene 1 antikoerper, eukaryotic translation elongation factor 2b antikoerper, Elongation factor 2 antikoerper, EEF2 antikoerper, Eef2 antikoerper, eef2.1 antikoerper, POSPLDRAFT_118836 antikoerper, eef2b antikoerper, eef-2 antikoerper, eef2 antikoerper, EF2 antikoerper

Hintergrund: EEF2 is a member of the GTP-binding translation elongation factor family. The protein is an essential factor for protein synthesis. It promotes the GTP-dependent translocation of the nascent protein chain from the A-site to the P-site of the ribosome. This protein is completely inactivated by EF-2 kinase phosporylation.

Molekulargewicht: 94 kDa (MW of target protein)

Pathways: AMPK Signaling