Aquaporin 7 Antikörper (C-Term)

Produktnummer ABIN630892

Produktdetails anti-Aquaporin 7 Antikörper

Target: Aquaporin 7 (AQP7)

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Aquaporin 7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Aquaporin 7 antibody was raised against the C terminal of AQP7

Aufreinigung: Affinity purified

Immunogen: Aquaporin 7 antibody was raised using the C terminal of AQP7 corresponding to a region with amino acids DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA

Anwendungsinformationen

Applikationshinweise: WB: 0.4 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Aquaporin 7 Blocking Peptide, catalog no. 33R-2182, is also available for use as a blocking control in assays to test for specificity of this Aquaporin 7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AQP7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Aquaporin 7

Target: Aquaporin 7 (AQP7)

Andere Bezeichnung: Aquaporin 7 (AQP7 Produkte)

Synonyme: fj98f09 antikoerper, wu:fj98f09 antikoerper, zgc:63700 antikoerper, aqp7l antikoerper, aqp9 antikoerper, aqpap antikoerper, AQP7 antikoerper, AQP7L antikoerper, AQP9 antikoerper, AQPap antikoerper, GLYCQTL antikoerper, SAQP7 antikoerper, aquaporin 7 antikoerper, aqp7 antikoerper, AQP7 antikoerper, Aqp7 antikoerper

Hintergrund: Aquaporins/major intrinsic protein (MIP) are a family of water-selective membrane channels. Aquaporin 7 has greater sequence similarity with AQP3 and AQP9 and they may be a subfamily. Aquaporin 7 and AQP3 are at the same chromosomal location suggesting that 9p13 may be a site of an aquaporin cluster. Aquaporin 7 facilitates water, glycerol and urea transport. It may play an important role in sperm function.

Molekulargewicht: 37 kDa (MW of target protein)