Aquaporin 7 Antikörper (C-Term)
-
- Target Alle Aquaporin 7 (AQP7) Antikörper anzeigen
- Aquaporin 7 (AQP7)
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Aquaporin 7 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Aquaporin 7 antibody was raised against the C terminal of AQP7
- Aufreinigung
- Affinity purified
- Immunogen
- Aquaporin 7 antibody was raised using the C terminal of AQP7 corresponding to a region with amino acids DSVAYEDHGITVLPKMGSHEPTISPLTPVSVSPANRSSVHPAPPLHESMA
- Top Product
- Discover our top product AQP7 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.4 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Aquaporin 7 Blocking Peptide, catalog no. 33R-2182, is also available for use as a blocking control in assays to test for specificity of this Aquaporin 7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AQP7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Aquaporin 7 (AQP7)
- Andere Bezeichnung
- Aquaporin 7 (AQP7 Produkte)
- Hintergrund
- Aquaporins/major intrinsic protein (MIP) are a family of water-selective membrane channels. Aquaporin 7 has greater sequence similarity with AQP3 and AQP9 and they may be a subfamily. Aquaporin 7 and AQP3 are at the same chromosomal location suggesting that 9p13 may be a site of an aquaporin cluster. Aquaporin 7 facilitates water, glycerol and urea transport. It may play an important role in sperm function.
- Molekulargewicht
- 37 kDa (MW of target protein)
-