PGK2 Antikörper (C-Term)

Produktnummer ABIN630896

Produktdetails anti-PGK2 Antikörper

Target: PGK2 (Phosphoglycerate Kinase 2 (PGK2))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PGK2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PGK2 antibody was raised against the C terminal of PGK2

Aufreinigung: Affinity purified

Immunogen: PGK2 antibody was raised using the C terminal of PGK2 corresponding to a region with amino acids ITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PGK2 Blocking Peptide, catalog no. 33R-4189, is also available for use as a blocking control in assays to test for specificity of this PGK2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGK2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PGK2

Target: PGK2 (Phosphoglycerate Kinase 2 (PGK2))

Andere Bezeichnung: PGK2 (PGK2 Produkte)

Synonyme: PGKB antikoerper, PGKPS antikoerper, dJ417L20.2 antikoerper, Pgk-2 antikoerper, Tcp-2 antikoerper, PGK2 antikoerper, phosphoglycerate kinase 2 antikoerper, PGK2 antikoerper, Pgk2 antikoerper, cbbK antikoerper

Hintergrund: PGK2 is a testis-specific form of phosphoglycerate kinase (EC 2.7.2.3), which catalyzes the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate during glycolysis, generating one molecule of ATP. The PGK2 gene encodes a testis-specific form of phosphoglycerate kinase (EC 2.7.2.3), which catalyzes the reversible conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate during glycolysis, generating one molecule of ATP.

Molekulargewicht: 46 kDa (MW of target protein)