ALDOC Antikörper (N-Term)
-
- Target Alle ALDOC Antikörper anzeigen
- ALDOC (Aldolase C, Fructose-Bisphosphate (ALDOC))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ALDOC Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ALDOC antibody was raised against the N terminal of ALDOC
- Aufreinigung
- Affinity purified
- Immunogen
- ALDOC antibody was raised using the N terminal of ALDOC corresponding to a region with amino acids MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVE
- Top Product
- Discover our top product ALDOC Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ALDOC Blocking Peptide, catalog no. 33R-6286, is also available for use as a blocking control in assays to test for specificity of this ALDOC antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDOC antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ALDOC (Aldolase C, Fructose-Bisphosphate (ALDOC))
- Andere Bezeichnung
- ALDOC (ALDOC Produkte)
- Synonyme
- ALDC antikoerper, MGC69434 antikoerper, ALDOC antikoerper, aldoc antikoerper, AI847350 antikoerper, AU040929 antikoerper, Aldo3 antikoerper, Scrg2 antikoerper, ALDCAA antikoerper, F16dip7 antikoerper, RATALDCAA antikoerper, aldocl antikoerper, wu:fj56h04 antikoerper, zgc:112357 antikoerper, QccE-21970 antikoerper, aldolase, fructose-bisphosphate C antikoerper, aldolase, fructose-bisphosphate C L homeolog antikoerper, aldolase C, fructose-bisphosphate, b antikoerper, aldolase C, fructose-bisphosphate antikoerper, aldolase A, fructose-bisphosphate antikoerper, aldolase C, fructose-bisphosphate, a antikoerper, Fructose-bisphosphate aldolase C antikoerper, ALDOC antikoerper, aldoc.L antikoerper, aldoc antikoerper, aldocb antikoerper, Aldoc antikoerper, ALDOA antikoerper, aldoca antikoerper
- Hintergrund
- ALDOC gene is a member of the class I fructose-biphosphate aldolase gene family. ALDOC is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively.
- Molekulargewicht
- 39 kDa (MW of target protein)
-