SULT1B1 Antikörper (N-Term)

Produktnummer ABIN630908

Produktdetails anti-SULT1B1 Antikörper

Target: SULT1B1 (Sulfotransferase Family 1B Member 1 (SULT1B1))

Bindungsspezifität: N-Term

Reaktivität: Human, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SULT1B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SULT1 B1 antibody was raised against the N terminal of SULT1 1

Aufreinigung: Affinity purified

Immunogen: SULT1 B1 antibody was raised using the N terminal of SULT1 1 corresponding to a region with amino acids KRGFITEKVPMLEMTLPGLRTSGIEQLEKNPSPRIVKTHLPTDLLPKSFW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SULT1B1 Blocking Peptide, catalog no. 33R-4623, is also available for use as a blocking control in assays to test for specificity of this SULT1B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SULT1B1

Target: SULT1B1 (Sulfotransferase Family 1B Member 1 (SULT1B1))

Andere Bezeichnung: SULT1B1 (SULT1B1 Produkte)

Synonyme: ST1B1 antikoerper, ST1B2 antikoerper, SULT1B2 antikoerper, St2b2 antikoerper, SULT1B antikoerper, cSULT1B1 antikoerper, MGC80677 antikoerper, SULT1B1 antikoerper, sulfotransferase family 1B member 1 antikoerper, sulfotransferase family 1B, member 1 antikoerper, sulfotransferase family cytosolic 1B member 1 antikoerper, sulfotransferase family 1B member 1 S homeolog antikoerper, sulfotransferase family, cytosolic, 1B, member 1 antikoerper, SULT1B1 antikoerper, Sult1b1 antikoerper, sult1b1.S antikoerper, sult1b1 antikoerper, LOC100624541 antikoerper

Hintergrund: SULT1B1 Catalyzes the sulfate conjugation of many hormones, neurotransmitters, drugs and xenobiotic compounds. Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites. Sulfates dopamine, small phenols such as 1-naphthol and p-nitrophenol and thyroid hormones, including 3,3'-diiodothyronine, triidothyronine, reverse triiodothyronine and thyroxine.

Molekulargewicht: 35 kDa (MW of target protein)