Transglutaminase 7 Antikörper (C-Term)

Produktnummer ABIN630909

Produktdetails anti-Transglutaminase 7 Antikörper

Target: Transglutaminase 7 (TGM7)

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Transglutaminase 7 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Transglutaminase 7 antibody was raised against the C terminal of TGM7

Aufreinigung: Affinity purified

Immunogen: Transglutaminase 7 antibody was raised using the C terminal of TGM7 corresponding to a region with amino acids TQKPFWRHTVRMNLDFGKETQWPLLLPYSNYRNKLTDEKLIRVSGIAEVE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Transglutaminase 7 Blocking Peptide, catalog no. 33R-9245, is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 7 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGM7 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Transglutaminase 7

Target: Transglutaminase 7 (TGM7)

Andere Bezeichnung: Transglutaminase 7 (TGM7 Produkte)

Synonyme: TGMZ antikoerper, TGM7 antikoerper, TGz antikoerper, transglutaminase 7 antikoerper, TGM7 antikoerper, Tgm7 antikoerper

Hintergrund: Transglutaminases (TGM, EC 2.3.2.13) are a family of structurally and functionally related enzymes that stabilize protein assemblies through the formation of gamma-glutamyl-epsilonlysine crosslinks. Transglutaminases (TGM, EC 2.3.2.13) are a family of structurally and functionally related enzymes that stabilize protein assemblies through the formation of gamma-glutamyl-epsilon lysine crosslinks.

Molekulargewicht: 80 kDa (MW of target protein)