GSTO2 Antikörper (N-Term)

Produktnummer ABIN630910

Produktdetails anti-GSTO2 Antikörper

Target: GSTO2 (Glutathione S-Transferase omega 2 (GSTO2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GSTO2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GSTO2 antibody was raised against the N terminal of GSTO2

Aufreinigung: Affinity purified

Immunogen: GSTO2 antibody was raised using the N terminal of GSTO2 corresponding to a region with amino acids VLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GSTO2 Blocking Peptide, catalog no. 33R-9654, is also available for use as a blocking control in assays to test for specificity of this GSTO2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTO2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GSTO2

Target: GSTO2 (Glutathione S-Transferase omega 2 (GSTO2))

Andere Bezeichnung: GSTO2 (GSTO2 Produkte)

Synonyme: GSTO 2-2 antikoerper, bA127L20.1 antikoerper, 1700020F09Rik antikoerper, 4930425C18Rik antikoerper, glutathione S-transferase omega 2 antikoerper, GSTO2 antikoerper, Gsto2 antikoerper

Hintergrund: The omega class glutathione transferases (GST, EC 2.5.1.18) have poor activity with common GST substrates, but exhibit novel glutathione-dependent thioltransferase, dehydroascorbate reductase, and monomethylarsonate reductase activities, and they modulate Ca(2+) release by ryanodine receptors (e.g., RYR1).

Molekulargewicht: 28 kDa (MW of target protein)