PEX5 Antikörper (N-Term)
-
- Target Alle PEX5 Antikörper anzeigen
- PEX5 (Peroxisomal Biogenesis Factor 5 (PEX5))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PEX5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PEX5 antibody was raised against the N terminal of PEX5
- Aufreinigung
- Affinity purified
- Immunogen
- PEX5 antibody was raised using the N terminal of PEX5 corresponding to a region with amino acids TATDRWYDEYHPEEDLQHTASDFVAKVDDPKLANSEFLKFVRQIGEGQVS
- Top Product
- Discover our top product PEX5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PEX5 Blocking Peptide, catalog no. 33R-8985, is also available for use as a blocking control in assays to test for specificity of this PEX5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PEX5 (Peroxisomal Biogenesis Factor 5 (PEX5))
- Andere Bezeichnung
- PEX5 (PEX5 Produkte)
- Hintergrund
- PEX5 binds to the C-terminal PTS1-type tripeptide peroxisomal targeting signal (SKL-type) and plays an essential role in peroxisomal protein import. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function.
- Molekulargewicht
- 70 kDa (MW of target protein)
- Pathways
- Monocarboxylic Acid Catabolic Process
-