PEX5 Antikörper (N-Term)

Produktnummer ABIN630915

Produktdetails anti-PEX5 Antikörper

Target: PEX5 (Peroxisomal Biogenesis Factor 5 (PEX5))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PEX5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PEX5 antibody was raised against the N terminal of PEX5

Aufreinigung: Affinity purified

Immunogen: PEX5 antibody was raised using the N terminal of PEX5 corresponding to a region with amino acids TATDRWYDEYHPEEDLQHTASDFVAKVDDPKLANSEFLKFVRQIGEGQVS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PEX5 Blocking Peptide, catalog no. 33R-8985, is also available for use as a blocking control in assays to test for specificity of this PEX5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PEX5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PEX5

Target: PEX5 (Peroxisomal Biogenesis Factor 5 (PEX5))

Andere Bezeichnung: PEX5 (PEX5 Produkte)

Synonyme: AW212715 antikoerper, ESTM1 antikoerper, PTS1R antikoerper, Pxr1 antikoerper, X83306 antikoerper, PTS1-BP antikoerper, PBD2A antikoerper, PBD2B antikoerper, PXR1 antikoerper, Peroxin-5 antikoerper, peroxisomal biogenesis factor 5 antikoerper, pex5 antikoerper, Pex5 antikoerper, PEX5 antikoerper

Hintergrund: PEX5 binds to the C-terminal PTS1-type tripeptide peroxisomal targeting signal (SKL-type) and plays an essential role in peroxisomal protein import. Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes. The peroxisome biogenesis disorders (PBDs) are a group of genetically heterogeneous autosomal recessive, lethal diseases characterized by multiple defects in peroxisome function.

Molekulargewicht: 70 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process