PSME3 Antikörper (N-Term)

Produktnummer ABIN630917

Produktdetails anti-PSME3 Antikörper

Target: PSME3

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSME3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: PSME3 antibody was raised against the N terminal of PSME3

Aufreinigung: Affinity purified

Immunogen: PSME3 antibody was raised using the N terminal of PSME3 corresponding to a region with amino acids PILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQ

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PSME3 Blocking Peptide, catalog no. 33R-7157, is also available for use as a blocking control in assays to test for specificity of this PSME3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSME3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PSME3

Target: PSME3

Andere Bezeichnung: PSME3 (PSME3 Produkte)

Synonyme: AA410043 antikoerper, AU020960 antikoerper, Ki antikoerper, PA28gamma antikoerper, REGgamma antikoerper, pa28g antikoerper, Ab2-371 antikoerper, PA28-gamma antikoerper, PA28G antikoerper, REG-GAMMA antikoerper, psme3b antikoerper, proteaseome (prosome, macropain) activator subunit 3 (PA28 gamma, Ki) antikoerper, proteasome activator subunit 3 antikoerper, proteasome activator subunit 3 S homeolog antikoerper, Psme3 antikoerper, PSME3 antikoerper, psme3.S antikoerper

Hintergrund: The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides.

Molekulargewicht: 31 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Positive Regulation of Endopeptidase Activity, Hepatitis C, Synthesis of DNA