PSMD8 Antikörper
-
- Target Alle PSMD8 Antikörper anzeigen
- PSMD8 (Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 8 (PSMD8))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PSMD8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PSMD8 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYAKKRGWVLGPNNYYSFASQQQKPEDTTIPSTELAKQVIEYARQLEMIV
- Top Product
- Discover our top product PSMD8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PSMD8 Blocking Peptide, catalog no. 33R-2234, is also available for use as a blocking control in assays to test for specificity of this PSMD8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMD8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSMD8 (Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 8 (PSMD8))
- Andere Bezeichnung
- PSMD8 (PSMD8 Produkte)
- Synonyme
- HIP6 antikoerper, HYPF antikoerper, Nin1p antikoerper, Rpn12 antikoerper, S14 antikoerper, p31 antikoerper, hip6 antikoerper, hypf antikoerper, nin1p antikoerper, rpn12 antikoerper, psmd8b antikoerper, 6720456J22Rik antikoerper, AA407360 antikoerper, AL033291 antikoerper, AL033322 antikoerper, AL033323 antikoerper, C76433 antikoerper, psmd8 antikoerper, psmd8a antikoerper, fa93g07 antikoerper, fb17c09 antikoerper, fb49a10 antikoerper, zgc:86762 antikoerper, wu:fa93g07 antikoerper, wu:fb17c09 antikoerper, wu:fb49a10 antikoerper, PSMD8 antikoerper, proteasome 26S subunit, non-ATPase 8 antikoerper, proteasome 26S subunit, non-ATPase 8 S homeolog antikoerper, proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 antikoerper, proteasome 26S subunit, non-ATPase 8 L homeolog antikoerper, proteasome (prosome, macropain) 26S subunit, non-ATPase, 8 pseudogene antikoerper, PSMD8 antikoerper, psmd8.S antikoerper, Psmd8 antikoerper, psmd8.L antikoerper, psmd8 antikoerper, LOC468490 antikoerper
- Hintergrund
- The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. PSMD8 is a non-ATPase subunit of the 19S regulator. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides.
- Molekulargewicht
- 27 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Proton Transport, Synthesis of DNA, SARS-CoV-2 Protein Interaktom, Ubiquitin Proteasome Pathway
-