PSMB5 Antikörper
-
- Target Alle PSMB5 Antikörper anzeigen
- PSMB5 (Proteasome (Prosome, Macropain) Subunit, beta Type, 5 (PSMB5))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PSMB5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PSMB5 antibody was raised using a synthetic peptide corresponding to a region with amino acids IVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQ
- Top Product
- Discover our top product PSMB5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PSMB5 Blocking Peptide, catalog no. 33R-4193, is also available for use as a blocking control in assays to test for specificity of this PSMB5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMB5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PSMB5 (Proteasome (Prosome, Macropain) Subunit, beta Type, 5 (PSMB5))
- Andere Bezeichnung
- PSMB5 (PSMB5 Produkte)
- Synonyme
- LMPX antikoerper, MB1 antikoerper, X antikoerper, etID309919.2 antikoerper, fb59c07 antikoerper, si:zc14a17.13 antikoerper, wu:fb59c07 antikoerper, x antikoerper, zgc:86820 antikoerper, proteasome subunit beta 5 antikoerper, proteasome (prosome, macropain) subunit, beta type 5 antikoerper, proteasome subunit beta 5 L homeolog antikoerper, proteasome (prosome, macropain) subunit, beta type, 5 antikoerper, PSMB5 antikoerper, psmb5 antikoerper, Psmb5 antikoerper, psmb5.L antikoerper
- Hintergrund
- The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMB5 is a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit in the proteasome.
- Molekulargewicht
- 28 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA
-