CAMLG Antikörper (N-Term)

Produktnummer ABIN630925

Produktdetails anti-CAMLG Antikörper

Target: CAMLG (Calcium Modulating Ligand (CAMLG))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CAMLG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CAMLG antibody was raised against the N terminal of CAMLG

Aufreinigung: Affinity purified

Immunogen: CAMLG antibody was raised using the N terminal of CAMLG corresponding to a region with amino acids LLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CAMLG Blocking Peptide, catalog no. 33R-5170, is also available for use as a blocking control in assays to test for specificity of this CAMLG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAMLG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CAMLG

Target: CAMLG (Calcium Modulating Ligand (CAMLG))

Andere Bezeichnung: CAMLG (CAMLG Produkte)

Synonyme: MGC53900 antikoerper, CAML antikoerper, AI385748 antikoerper, Camlg antikoerper, Caml antikoerper, calcium modulating ligand L homeolog antikoerper, calcium modulating ligand antikoerper, camlg.L antikoerper, CAMLG antikoerper, camlg antikoerper, Caml antikoerper, Camlg antikoerper

Hintergrund: The immunosuppressant drug cyclosporin A blocks a calcium-dependent signal from the T-cell receptor (TCR) that normally leads to T-cell activation. When bound to cyclophilin B, cyclosporin A binds and inactivates the key signaling intermediate calcineurin. CAMLG functions similarly to cyclosporin A, binding to cyclophilin B and acting downstream of the TCR and upstream of calcineurin by causing an influx of calcium. This integral membrane protein appears to be a new participant in the calcium signal transduction pathway, implicating cyclophilin B in calcium signaling, even in the absence of cyclosporin.

Molekulargewicht: 33 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway