Gasdermin B Antikörper (N-Term)

Produktnummer ABIN630929

Produktdetails anti-Gasdermin B Antikörper

Target: Gasdermin B (GSDMB)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Gasdermin B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GSDML antibody was raised against the N terminal of GSDML

Aufreinigung: Affinity purified

Immunogen: GSDML antibody was raised using the N terminal of GSDML corresponding to a region with amino acids HLVGEKRTFFGCRHYTTGLTLMDILDTDGDKWLDELDSGLQGQKAEFQIL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GSDML Blocking Peptide, catalog no. 33R-3791, is also available for use as a blocking control in assays to test for specificity of this GSDML antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSDML antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Gasdermin B

Target: Gasdermin B (GSDMB)

Andere Bezeichnung: GSDML (GSDMB Produkte)

Synonyme: GSDML antikoerper, PRO2521 antikoerper, gasdermin B antikoerper, GSDMB antikoerper

Hintergrund: GSDML belongs to the gasdermin family.GSDML may play a role as secretory or metabolic product involved in secretory pathway. It may also play a role in achieving and maintaining the final differentiation state of epithelial cells.

Molekulargewicht: 45 kDa (MW of target protein)