MAP3K1 Antikörper (C-Term)
-
- Target Alle MAP3K1 Antikörper anzeigen
- MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MAP3K1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MAP3 K1 antibody was raised against the C terminal of MAP3 1
- Aufreinigung
- Affinity purified
- Immunogen
- MAP3 K1 antibody was raised using the C terminal of MAP3 1 corresponding to a region with amino acids LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH
- Top Product
- Discover our top product MAP3K1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MAP3K1 Blocking Peptide, catalog no. 33R-4960, is also available for use as a blocking control in assays to test for specificity of this MAP3K1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAP0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MAP3K1 (Mitogen-Activated Protein Kinase Kinase Kinase 1 (MAP3K1))
- Andere Bezeichnung
- MAP3K1 (MAP3K1 Produkte)
- Hintergrund
- MAP3K, or MEK kinase, is a serine/threonine kinase that occupies a pivotal role in a network of phosphorylating enzymes integrating cellular responses to a number of mitogenic and metabolic stimuli, including insulin and many growth factors.
- Molekulargewicht
- 164 kDa (MW of target protein)
- Pathways
- MAPK Signalweg, Interferon-gamma Pathway, Caspase Kaskade in der Apoptose, TLR Signalweg, Fc-epsilon Rezeptor Signalübertragung, Activation of Innate immune Response, Regulation of Actin Filament Polymerization, Toll-Like Receptors Cascades
-