LASP1 Antikörper (C-Term)
-
- Target Alle LASP1 Antikörper anzeigen
- LASP1 (LIM and SH3 Protein 1 (LASP1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LASP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LASP1 antibody was raised against the C terminal of LASP1
- Aufreinigung
- Affinity purified
- Immunogen
- LASP1 antibody was raised using the C terminal of LASP1 corresponding to a region with amino acids SYGGYKEPAAPVSIQRSAPGGGGKRYRAVYDYSAADEDEVSFQDGDTIVN
- Top Product
- Discover our top product LASP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LASP1 Blocking Peptide, catalog no. 33R-8949, is also available for use as a blocking control in assays to test for specificity of this LASP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LASP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LASP1 (LIM and SH3 Protein 1 (LASP1))
- Andere Bezeichnung
- LASP1 (LASP1 Produkte)
- Hintergrund
- LASP1 is a member of a LIM protein subfamily characterized by a LIM motif and a domain of Src homology region 3. It functions as an actin-binding protein and possibly in cytoskeletal organization.
- Molekulargewicht
- 30 kDa (MW of target protein)
-