ACTRT2 Antikörper (C-Term)
-
- Target Alle ACTRT2 Antikörper anzeigen
- ACTRT2 (Actin-Related Protein T2 (ACTRT2))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ACTRT2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ACTRT2 antibody was raised against the C terminal of ACTRT2
- Aufreinigung
- Affinity purified
- Immunogen
- ACTRT2 antibody was raised using the C terminal of ACTRT2 corresponding to a region with amino acids LDDRLLKELEQLASKDTPIKITAPPDRWFSTWIGASIVTSLSSFKQMWVT
- Top Product
- Discover our top product ACTRT2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ACTRT2 Blocking Peptide, catalog no. 33R-4842, is also available for use as a blocking control in assays to test for specificity of this ACTRT2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTRT2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACTRT2 (Actin-Related Protein T2 (ACTRT2))
- Andere Bezeichnung
- ACTRT2 (ACTRT2 Produkte)
- Hintergrund
- ACTRT2 belongs to the actin family. Studies have shown that this protein may be involved in cytoskeletal organization similar to other cytoplasmic actin-related protein (ARP) subfamily members. Antibody raised against the human protein has been used to detect the protein by immunoblotting and immunofluorescence microscopy, demonstrating its specific synthesis in the testis, late in spermatid differentiation, and its localization in the calyx.
- Molekulargewicht
- 42 kDa (MW of target protein)
-