ACTRT2 Antikörper (C-Term)

Produktnummer ABIN630957

Produktdetails anti-ACTRT2 Antikörper

Target: ACTRT2 (Actin-Related Protein T2 (ACTRT2))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACTRT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACTRT2 antibody was raised against the C terminal of ACTRT2

Aufreinigung: Affinity purified

Immunogen: ACTRT2 antibody was raised using the C terminal of ACTRT2 corresponding to a region with amino acids LDDRLLKELEQLASKDTPIKITAPPDRWFSTWIGASIVTSLSSFKQMWVT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACTRT2 Blocking Peptide, catalog no. 33R-4842, is also available for use as a blocking control in assays to test for specificity of this ACTRT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTRT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACTRT2

Target: ACTRT2 (Actin-Related Protein T2 (ACTRT2))

Andere Bezeichnung: ACTRT2 (ACTRT2 Produkte)

Synonyme: ARPM2 antikoerper, ARPT2 antikoerper, Arp-T2 antikoerper, HARPM2 antikoerper, 1700052K15Rik antikoerper, Arpm2 antikoerper, actin related protein T2 antikoerper, actin-related protein T2 antikoerper, ACTRT2 antikoerper, Actrt2 antikoerper

Hintergrund: ACTRT2 belongs to the actin family. Studies have shown that this protein may be involved in cytoskeletal organization similar to other cytoplasmic actin-related protein (ARP) subfamily members. Antibody raised against the human protein has been used to detect the protein by immunoblotting and immunofluorescence microscopy, demonstrating its specific synthesis in the testis, late in spermatid differentiation, and its localization in the calyx.

Molekulargewicht: 42 kDa (MW of target protein)