SPAG8 Antikörper (Middle Region)
-
- Target Alle SPAG8 Antikörper anzeigen
- SPAG8 (Sperm Associated Antigen 8 (SPAG8))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SPAG8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SPAG8 antibody was raised against the middle region of SPAG8
- Aufreinigung
- Affinity purified
- Immunogen
- SPAG8 antibody was raised using the middle region of SPAG8 corresponding to a region with amino acids PAPTKPHDYRQEQPETFWIQRAPQLPTWWPLPTQVPAAEDYLTWKEWGFT
- Top Product
- Discover our top product SPAG8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SPAG8 Blocking Peptide, catalog no. 33R-6974, is also available for use as a blocking control in assays to test for specificity of this SPAG8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPAG8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SPAG8 (Sperm Associated Antigen 8 (SPAG8))
- Andere Bezeichnung
- SPAG8 (SPAG8 Produkte)
- Synonyme
- BS-84 antikoerper, HSD-1 antikoerper, SMP1 antikoerper, SPAG3 antikoerper, hSMP-1 antikoerper, MH-SPAG8 antikoerper, sperm associated antigen 8 antikoerper, SPAG8 antikoerper, Spag8 antikoerper
- Hintergrund
- The correlation of anti-sperm antibodies with cases of unexplained infertility implicates a role for these antibodies in blocking fertilization. Improved diagnosis and treatment of immunologic infertility, as well as identification of proteins for targeted contraception, are dependent on the identification and characterization of relevant sperm antigens. SPAG8 is recognised by sperm agglutinating antibodies from an infertile woman. This protein is localized in germ cells of the testis at all stages of spermatogenesis and is localized to the acrosomal region of mature spermatozoa.
- Molekulargewicht
- 53 kDa (MW of target protein)
-