DPPA2 Antikörper (N-Term)
-
- Target Alle DPPA2 Antikörper anzeigen
- DPPA2 (Developmental Pluripotency Associated 2 (DPPA2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DPPA2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DPPA2 antibody was raised against the N terminal of DPPA2
- Aufreinigung
- Affinity purified
- Immunogen
- DPPA2 antibody was raised using the N terminal of DPPA2 corresponding to a region with amino acids NMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPL
- Top Product
- Discover our top product DPPA2 Primärantikörper
-
anti-Developmental Pluripotency Associated 2 (DPPA2) (AA 1-298) antibody
DPPA2 Reaktivität: Human WB Wirt: Maus Polyclonal unconjugated
anti-Developmental Pluripotency Associated 2 (DPPA2) (AA 1-175) antibodyDPPA2 Reaktivität: Human, Ratte, Hund WB Wirt: Maus Monoclonal 1G10 unconjugated
anti-Developmental Pluripotency Associated 2 (DPPA2) antibodyDPPA2 Reaktivität: Human WB Wirt: Maus Monoclonal 210CT5-14-6-1 unconjugated
anti-Developmental Pluripotency Associated 2 (DPPA2) (AA 1-200) antibodyDPPA2 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Developmental Pluripotency Associated 2 (DPPA2) (AA 36-85) antibodyDPPA2 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DPPA2 Blocking Peptide, catalog no. 33R-6792, is also available for use as a blocking control in assays to test for specificity of this DPPA2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPPA2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DPPA2 (Developmental Pluripotency Associated 2 (DPPA2))
- Andere Bezeichnung
- DPPA2 (DPPA2 Produkte)
- Synonyme
- 2410088E07Rik antikoerper, C80932 antikoerper, D19Mgi18 antikoerper, ECAT15-2 antikoerper, CT100 antikoerper, PESCRG1 antikoerper, developmental pluripotency associated 2 antikoerper, ABC-type oliopeptide/dipeptide transporter, periplasmic binding protein DppA antikoerper, Dppa2 antikoerper, DPPA2 antikoerper, dppA2 antikoerper
- Hintergrund
- DPPA2 may play a role in maintaining cell pluripotentiality. ECSA/DPPA2 is a promising target for antigen-specific immunotherapy in non-small cell lung cancers.
- Molekulargewicht
- 34 kDa (MW of target protein)
- Pathways
- Stem Cell Maintenance
-
