PDE1C Antikörper (N-Term)
-
- Target Alle PDE1C Antikörper anzeigen
- PDE1C (phosphodiesterase 1C, Calmodulin-Dependent 70kDa (PDE1C))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PDE1C Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PDE1 C antibody was raised against the N terminal of PDE1
- Aufreinigung
- Affinity purified
- Immunogen
- PDE1 C antibody was raised using the N terminal of PDE1 corresponding to a region with amino acids DLKKNIEYAASVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLAST
- Top Product
- Discover our top product PDE1C Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PDE1C Blocking Peptide, catalog no. 33R-2051, is also available for use as a blocking control in assays to test for specificity of this PDE1C antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PDE1C (phosphodiesterase 1C, Calmodulin-Dependent 70kDa (PDE1C))
- Andere Bezeichnung
- PDE1C (PDE1C Produkte)
- Hintergrund
- PDE1A belongs to the cyclic nucleotide phosphodiesterase family. It has a higher affinity for cGMP than for cAMP. The exact function of PDE1A remains unknown.
- Molekulargewicht
- 59 kDa (MW of target protein)
- Pathways
- EGFR Signaling Pathway, Neurotrophin Signalübertragung, Negative Regulation of Hormone Secretion, cAMP Metabolic Process, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma
-