PDE1C Antikörper (N-Term)

Produktnummer ABIN630963

Produktdetails anti-PDE1C Antikörper

Target: PDE1C (phosphodiesterase 1C, Calmodulin-Dependent 70kDa (PDE1C))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PDE1C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PDE1 C antibody was raised against the N terminal of PDE1

Aufreinigung: Affinity purified

Immunogen: PDE1 C antibody was raised using the N terminal of PDE1 corresponding to a region with amino acids DLKKNIEYAASVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLAST

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PDE1C Blocking Peptide, catalog no. 33R-2051, is also available for use as a blocking control in assays to test for specificity of this PDE1C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDE0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PDE1C

Target: PDE1C (phosphodiesterase 1C, Calmodulin-Dependent 70kDa (PDE1C))

Andere Bezeichnung: PDE1C (PDE1C Produkte)

Synonyme: CG14940 antikoerper, CG14942 antikoerper, CG14943 antikoerper, CG14944 antikoerper, CG31757 antikoerper, CG31758 antikoerper, CG42325 antikoerper, CG44007 antikoerper, Dmel\\CG44007 antikoerper, Dmel_CG14940 antikoerper, Dmel_CG14943 antikoerper, Dmel_CG14944 antikoerper, Dmel_CG31757 antikoerper, Dmel_CG31758 antikoerper, Dmel_CG42325 antikoerper, PDE1C antikoerper, PDE1c antikoerper, GB13690 antikoerper, Hcam3 antikoerper, Phosphodiesterase 1c antikoerper, phosphodiesterase 1C antikoerper, calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A antikoerper, calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1C antikoerper, phosphodiesterase 1C, calmodulin-dependent b antikoerper, Pde1c antikoerper, PDE1C antikoerper, LOC724389 antikoerper, LOC100019026 antikoerper, pde1cb antikoerper

Hintergrund: PDE1A belongs to the cyclic nucleotide phosphodiesterase family. It has a higher affinity for cGMP than for cAMP. The exact function of PDE1A remains unknown.

Molekulargewicht: 59 kDa (MW of target protein)

Pathways: EGFR Signaling Pathway, Neurotrophin Signalübertragung, Negative Regulation of Hormone Secretion, cAMP Metabolic Process, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma