FLJ11730 (N-Term) Antikörper
-
- Target
- FLJ11730
- Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Unkonjugiert
-
Applikation
- Immunohistochemistry (IHC), Western Blotting (WB)
- Spezifität
- FLJ11730 antibody was raised against the N terminal Of Flj11730
- Aufreinigung
- Affinity purified
- Immunogen
- FLJ11730 antibody was raised using the N terminal Of Flj11730 corresponding to a region with amino acids HNKAAPPQIPDTRRELAELVKRKQELAETLANLERQIYAFEGSYLEDTQM
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FLJ11730 Blocking Peptide, catalog no. 33R-3801, is also available for use as a blocking control in assays to test for specificity of this FLJ11730 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ11730 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FLJ11730
- Hintergrund
- The screening of cDNA expression libraries from human tumors with serum antibody (SEREX) has proven to be a powerful method for identifying the repertoire of tumor antigens recognised by the immune system of cancer patients, referred to as the cancer immunome. In this regard, cancer/testis (CT) antigens are of particular interest because of their immunogenicity and restricted expression patterns. Synoivial sarcomas are striking with regard to CT antigen expression, however, highly expressed in sarcoma, CT antigens do not induce frequent humoral immune responses in sarcoma patients. Sera from two patients were used to immunoscreen cDNA libraries from two synovial sarcoma cell lines and normal testis, resulting in the identification of 113 distinct antigens. Sarcoma antigen NY-SAR-91 is one of them.
- Molekulargewicht
- 23 kDa (MW of target protein)
-