CNN2 Antikörper (N-Term)

Produktnummer ABIN630968

Produktdetails anti-CNN2 Antikörper

Target: CNN2 (Calponin 2 (CNN2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CNN2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Calponin 2 antibody was raised against the N terminal of CNN2

Aufreinigung: Affinity purified

Immunogen: Calponin 2 antibody was raised using the N terminal of CNN2 corresponding to a region with amino acids MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Calponin 2 Blocking Peptide, catalog no. 33R-6515, is also available for use as a blocking control in assays to test for specificity of this Calponin 2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNN2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CNN2

Target: CNN2 (Calponin 2 (CNN2))

Andere Bezeichnung: Calponin 2 (CNN2 Produkte)

Synonyme: Calponin-2 antikoerper, CNN2 antikoerper, DKFZp468N0916 antikoerper, cnn2 antikoerper, AA408047 antikoerper, AI324678 antikoerper, Calpo2 antikoerper, wu:fb36d03 antikoerper, wu:fb93a05 antikoerper, wz2414 antikoerper, zgc:65794 antikoerper, MGC82320 antikoerper, MGC108411 antikoerper, calponin 2 antikoerper, calponin 2 L homeolog antikoerper, calponin 2 pseudogene antikoerper, CNN2 antikoerper, cnn2 antikoerper, Cnn2 antikoerper, cnn2.L antikoerper, LOC450419 antikoerper

Hintergrund: CNN2, which can bind actin, calmodulin, troponin C, and tropomyosin, may function in the structural organization of actin filaments. CNN2 could play a role in smooth muscle contraction and cell adhesion.

Molekulargewicht: 34 kDa (MW of target protein)