DLGAP5 Antikörper (N-Term)
-
- Target Alle DLGAP5 Antikörper anzeigen
- DLGAP5 (Discs, Large (Drosophila) Homolog-Associated Protein 5 (DLGAP5))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DLGAP5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DLG7 antibody was raised against the N terminal Of Dlg7
- Aufreinigung
- Affinity purified
- Immunogen
- DLG7 antibody was raised using the N terminal Of Dlg7 corresponding to a region with amino acids EYERNRHFGLKDVNIPTLEGRILVELDETSQELVPEKTNVKPRAMKTILG
- Top Product
- Discover our top product DLGAP5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DLG7 Blocking Peptide, catalog no. 33R-2820, is also available for use as a blocking control in assays to test for specificity of this DLG7 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLG7 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DLGAP5 (Discs, Large (Drosophila) Homolog-Associated Protein 5 (DLGAP5))
- Andere Bezeichnung
- DLG7 (DLGAP5 Produkte)
- Hintergrund
- DLG7 is a potential cell cycle regulator that may play a role in carcinogenesis of cancer cells. It is a mitotic phosphoprotein regulated by the ubiquitin-proteasome pathway. DLG7 is the key regulator of adherens junction integrity and differentiation that may be involved in CDH1-mediated adhesion and signaling in epithelial cells.
- Molekulargewicht
- 95 kDa (MW of target protein)
- Pathways
- M Phase
-