GCDH Antikörper (N-Term)

Produktnummer ABIN630975

Produktdetails anti-GCDH Antikörper

Target: GCDH (Glutaryl-CoA Dehydrogenase (GCDH))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GCDH Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GCDH antibody was raised against the N terminal of GCDH

Aufreinigung: Affinity purified

Immunogen: GCDH antibody was raised using the N terminal of GCDH corresponding to a region with amino acids SLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLTEPNSGSDPSSMETRA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GCDH Blocking Peptide, catalog no. 33R-8632, is also available for use as a blocking control in assays to test for specificity of this GCDH antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GCDH antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GCDH

Target: GCDH (Glutaryl-CoA Dehydrogenase (GCDH))

Andere Bezeichnung: GCDH (GCDH Produkte)

Synonyme: ACAD5 antikoerper, GCD antikoerper, zgc:56505 antikoerper, zgc:77704 antikoerper, 9030411L18 antikoerper, AI266902 antikoerper, D17825 antikoerper, glutaryl-CoA dehydrogenase antikoerper, glutaryl-CoA dehydrogenase a antikoerper, glutaryl-Coenzyme A dehydrogenase antikoerper, GCDH antikoerper, Gcdh antikoerper, gcdha antikoerper

Hintergrund: GCDH belongs to the acyl-CoA dehydrogenase family. It catalyzes the oxidative decarboxylation of glutaryl-CoA to crotonyl-CoA and CO(2) in the degradative pathway of L-lysine, L-hydroxylysine, and L-tryptophan metabolism. It uses electron transfer flavoprotein as its electron acceptor. The enzyme exists in the mitochondrial matrix as a homotetramer of 45 kDa subunits.

Molekulargewicht: 43 kDa (MW of target protein)