CDT2/RAMP Antikörper
-
- Target Alle CDT2/RAMP (DTL) Antikörper anzeigen
- CDT2/RAMP (DTL) (Denticleless E3 Ubiquitin Protein Ligase Homolog (DTL))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CDT2/RAMP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DTL antibody was raised using a synthetic peptide corresponding to a region with amino acids VNQISGAHNTSDKQTPSKPKKKQNSKGLAPSVDFQQSVTVVLFQDENTLV
- Top Product
- Discover our top product DTL Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DTL Blocking Peptide, catalog no. 33R-9712, is also available for use as a blocking control in assays to test for specificity of this DTL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DTL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CDT2/RAMP (DTL) (Denticleless E3 Ubiquitin Protein Ligase Homolog (DTL))
- Andere Bezeichnung
- DTL (DTL Produkte)
- Synonyme
- CDT2 antikoerper, DCAF2 antikoerper, L2DTL antikoerper, RAMP antikoerper, 2810047L02Rik antikoerper, 5730564G15Rik antikoerper, Ramp antikoerper, RGD1310439 antikoerper, cdt2 antikoerper, cdt2-a antikoerper, dcaf2 antikoerper, l2dtl antikoerper, ramp antikoerper, cb151 antikoerper, chunp6871 antikoerper, wu:fb54b02 antikoerper, denticleless E3 ubiquitin protein ligase homolog antikoerper, denticleless E3 ubiquitin protein ligase antikoerper, denticleless E3 ubiquitin protein ligase homolog S homeolog antikoerper, denticleless E3 ubiquitin protein ligase homolog (Drosophila) antikoerper, DTL antikoerper, Dtl antikoerper, dtl.S antikoerper, dtl antikoerper
- Hintergrund
- DTL is required for CDT1 proteolysis in response to DNA damage through the CUL4-DDB1 E3 ubiquitin-protein ligase. It seems to be necessary to ensure proper cell cycle regulation of DNA replication. DTL may function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex. It also may play a role in cell proliferation of NT2 embryonal carcinoma cells.
- Molekulargewicht
- 79 kDa (MW of target protein)
-