MRPS12 Antikörper (N-Term)

Produktnummer ABIN630980

Produktdetails anti-MRPS12 Antikörper

Target: MRPS12 (Mitochondrial Ribosomal Protein S12 (MRPS12))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MRPS12 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MRPS12 antibody was raised against the N terminal of MRPS12

Aufreinigung: Affinity purified

Immunogen: MRPS12 antibody was raised using the N terminal of MRPS12 corresponding to a region with amino acids LVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRK

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MRPS12 Blocking Peptide, catalog no. 33R-5533, is also available for use as a blocking control in assays to test for specificity of this MRPS12 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPS12 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MRPS12

Target: MRPS12 (Mitochondrial Ribosomal Protein S12 (MRPS12))

Andere Bezeichnung: MRPS12 (MRPS12 Produkte)

Hintergrund: Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPS12 is the 28S subunit protein that belongs to the ribosomal protein S12P family. The protein is a key component of the ribosomal small subunit and controls the decoding fidelity and susceptibility to aminoglycoside antibiotics.Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion.

Molekulargewicht: 12 kDa (MW of target protein)

Pathways: Sensory Perception of Sound