WARS2 Antikörper (Middle Region)
-
- Target Alle WARS2 Antikörper anzeigen
- WARS2 (Tryptophanyl tRNA Synthetase 2, Mitochondrial (WARS2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser WARS2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- WARS2 antibody was raised against the middle region of WARS2
- Aufreinigung
- Affinity purified
- Immunogen
- WARS2 antibody was raised using the middle region of WARS2 corresponding to a region with amino acids TTKQKHDGTVGLLTYPVLQAADILLYKSTHVPVGEDQVQHMELVQDLAQG
- Top Product
- Discover our top product WARS2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
WARS2 Blocking Peptide, catalog no. 33R-9322, is also available for use as a blocking control in assays to test for specificity of this WARS2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WARS2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WARS2 (Tryptophanyl tRNA Synthetase 2, Mitochondrial (WARS2))
- Andere Bezeichnung
- WARS2 (WARS2 Produkte)
- Synonyme
- 5730427B17Rik antikoerper, 9430020O07Rik antikoerper, AI413375 antikoerper, TrpRS antikoerper, zgc:110828 antikoerper, tryptophanyl tRNA synthetase 2, mitochondrial antikoerper, tryptophanyl tRNA synthetase 2 (mitochondrial) antikoerper, WARS2 antikoerper, Wars2 antikoerper, wars2 antikoerper
- Hintergrund
- Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. WARS2 is the mitochondrial tryptophanyl-tRNA synthetase.
- Molekulargewicht
- 24 kDa (MW of target protein)
-