MRPL28 Antikörper (Middle Region)
-
- Target Alle MRPL28 Antikörper anzeigen
- MRPL28 (Mitochondrial Ribosomal Protein L28 (MRPL28))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MRPL28 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MRPL28 antibody was raised against the middle region of MRPL28
- Aufreinigung
- Affinity purified
- Immunogen
- MRPL28 antibody was raised using the middle region of MRPL28 corresponding to a region with amino acids EDPERRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFK
- Top Product
- Discover our top product MRPL28 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MRPL28 Blocking Peptide, catalog no. 33R-2324, is also available for use as a blocking control in assays to test for specificity of this MRPL28 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL28 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MRPL28 (Mitochondrial Ribosomal Protein L28 (MRPL28))
- Andere Bezeichnung
- MRPL28 (MRPL28 Produkte)
- Synonyme
- MAAT1 antikoerper, p15 antikoerper, CG3782 antikoerper, Dmel\\CG3782 antikoerper, MRP-L28 antikoerper, 1110015G04Rik antikoerper, L28mt antikoerper, GB14554 antikoerper, MRPL28 antikoerper, maat1 antikoerper, wu:fa96b11 antikoerper, zgc:110013 antikoerper, mitochondrial ribosomal protein L28 antikoerper, 39S ribosomal protein L28, mitochondrial antikoerper, mitochondrial ribosomal protein L28 L homeolog antikoerper, mitochondrial 54S ribosomal protein YmL28 antikoerper, mitochondrial ribosomal protein subunit L28 (predicted) antikoerper, Putative mitochondrial ribosomal protein L28 antikoerper, MRPL28 antikoerper, mRpL28 antikoerper, Mrpl28 antikoerper, LOC412473 antikoerper, mrpl28.L antikoerper, mrpl28 antikoerper, CAALFM_C108520CA antikoerper
- Hintergrund
- Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.
- Molekulargewicht
- 30 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases
-