MRPL15 Antikörper (N-Term)
-
- Target Alle MRPL15 Antikörper anzeigen
- MRPL15 (Mitochondrial Ribosomal Protein L15 (MRPL15))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MRPL15 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MRPL15 antibody was raised against the N terminal of MRPL15
- Aufreinigung
- Affinity purified
- Immunogen
- MRPL15 antibody was raised using the N terminal of MRPL15 corresponding to a region with amino acids KPERRPRGRRRGRKCGRGHKGERQRGTRPRLGFEGGQTPFYIRIPKYGFN
- Top Product
- Discover our top product MRPL15 Primärantikörper
-
anti-Mitochondrial Ribosomal Protein L15 (MRPL15) (Internal Region) antibody
MRPL15 Reaktivität: Human, Maus, Ratte WB, ELISA, IHC, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Mitochondrial Ribosomal Protein L15 (MRPL15) (Center) antibodyMRPL15 Reaktivität: Human, Maus, Affe WB, IHC, IF, IP, IC Wirt: Kaninchen Polyclonal unconjugated
anti-Mitochondrial Ribosomal Protein L15 (MRPL15) (Internal Region) antibodyMRPL15 Reaktivität: Human WB, ELISA, IHC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Mitochondrial Ribosomal Protein L15 (MRPL15) (AA 35-84) antibodyMRPL15 Reaktivität: Human, Maus, Ratte, Kaninchen, Zebrafisch (Danio rerio), Hund, Rind (Kuh), Meerschweinchen, Pferd, Affe, Schwein, Fledermaus, Xenopus laevis, Huhn WB Wirt: Kaninchen Polyclonal unconjugated
anti-Mitochondrial Ribosomal Protein L15 (MRPL15) (C-Term) antibodyMRPL15 Reaktivität: Human, Maus, Ratte, Kaninchen, Zebrafisch (Danio rerio), Hund, Schwein, Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
anti-Mitochondrial Ribosomal Protein L15 (MRPL15) (C-Term) antibodyMRPL15 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Mitochondrial Ribosomal Protein L15 (MRPL15) (N-Term) antibodyMRPL15 Reaktivität: Human, Maus, Ratte, Kaninchen, Zebrafisch (Danio rerio), Hund, Rind (Kuh), Meerschweinchen, Pferd WB Wirt: Kaninchen Polyclonal unconjugated
anti-Mitochondrial Ribosomal Protein L15 (MRPL15) (C-Term) antibodyMRPL15 Reaktivität: Human, Maus, Ratte, Kaninchen, Zebrafisch (Danio rerio), Hund, Rind (Kuh), Meerschweinchen, Pferd, Schwein WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MRPL15 Blocking Peptide, catalog no. 33R-4583, is also available for use as a blocking control in assays to test for specificity of this MRPL15 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL15 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MRPL15 (Mitochondrial Ribosomal Protein L15 (MRPL15))
- Andere Bezeichnung
- MRPL15 (MRPL15 Produkte)
- Synonyme
- L15mt antikoerper, MRP-L15 antikoerper, MRP-L7 antikoerper, RPML7 antikoerper, HSPC145 antikoerper, Rpml7 antikoerper, zgc:92856 antikoerper, mitochondrial ribosomal protein L15 antikoerper, mitochondrial ribosomal protein L15 L homeolog antikoerper, MRPL15 antikoerper, Mrpl15 antikoerper, mrpl15 antikoerper, mrpl15.L antikoerper
- Hintergrund
- Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPL15 belongs to the ribosomal protein L15P family. It is a 39S subunit protein that belongs to the EcoL15 ribosomal protein family.
- Molekulargewicht
- 33 kDa (MW of target protein)
-
