MRPL37 Antikörper (N-Term)
-
- Target Alle MRPL37 Antikörper anzeigen
- MRPL37 (Mitochondrial Ribosomal Protein L37 (MRPL37))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MRPL37 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MRPL37 antibody was raised against the N terminal of MRPL37
- Aufreinigung
- Affinity purified
- Immunogen
- MRPL37 antibody was raised using the N terminal of MRPL37 corresponding to a region with amino acids VRSTRKSEPPPLDRVYEIPGLEPITFAGKMHFVPWLARPIFPPWDRGYKD
- Top Product
- Discover our top product MRPL37 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MRPL37 Blocking Peptide, catalog no. 33R-9789, is also available for use as a blocking control in assays to test for specificity of this MRPL37 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL37 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MRPL37 (Mitochondrial Ribosomal Protein L37 (MRPL37))
- Andere Bezeichnung
- MRPL37 (MRPL37 Produkte)
- Synonyme
- L37mt antikoerper, MRP-L2 antikoerper, MRP-L37 antikoerper, MRPL2 antikoerper, RPML2 antikoerper, 2300004O14Rik antikoerper, AI132596 antikoerper, Rpml2 antikoerper, mitochondrial ribosomal protein L37 antikoerper, MRPL37 antikoerper, Mrpl37 antikoerper
- Hintergrund
- Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.
- Molekulargewicht
- 48 kDa (MW of target protein)
-