MRPL37 Antikörper (N-Term)

Produktnummer ABIN630997

Produktdetails anti-MRPL37 Antikörper

Target: MRPL37 (Mitochondrial Ribosomal Protein L37 (MRPL37))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MRPL37 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MRPL37 antibody was raised against the N terminal of MRPL37

Aufreinigung: Affinity purified

Immunogen: MRPL37 antibody was raised using the N terminal of MRPL37 corresponding to a region with amino acids VRSTRKSEPPPLDRVYEIPGLEPITFAGKMHFVPWLARPIFPPWDRGYKD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MRPL37 Blocking Peptide, catalog no. 33R-9789, is also available for use as a blocking control in assays to test for specificity of this MRPL37 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL37 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MRPL37

Target: MRPL37 (Mitochondrial Ribosomal Protein L37 (MRPL37))

Andere Bezeichnung: MRPL37 (MRPL37 Produkte)

Synonyme: L37mt antikoerper, MRP-L2 antikoerper, MRP-L37 antikoerper, MRPL2 antikoerper, RPML2 antikoerper, 2300004O14Rik antikoerper, AI132596 antikoerper, Rpml2 antikoerper, mitochondrial ribosomal protein L37 antikoerper, MRPL37 antikoerper, Mrpl37 antikoerper

Hintergrund: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.

Molekulargewicht: 48 kDa (MW of target protein)