ALAS1 Antikörper (N-Term)

Produktnummer ABIN631001

Produktdetails anti-ALAS1 Antikörper

Target: ALAS1 (Aminolevulinate, delta-, Synthase 1 (ALAS1))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALAS1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ALAS1 antibody was raised against the N terminal of ALAS1

Aufreinigung: Affinity purified

Immunogen: ALAS1 antibody was raised using the N terminal of ALAS1 corresponding to a region with amino acids ETSAGPSVVSVKTDGGDPSGLLKNFQDIMQKQRPERVSHLLQDNLPKSVS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALAS1 Blocking Peptide, catalog no. 33R-2769, is also available for use as a blocking control in assays to test for specificity of this ALAS1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALAS1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALAS1

Target: ALAS1 (Aminolevulinate, delta-, Synthase 1 (ALAS1))

Andere Bezeichnung: ALAS1 (ALAS1 Produkte)

Synonyme: ALAS antikoerper, ALAS3 antikoerper, ALASH antikoerper, MIG4 antikoerper, ALAS-N antikoerper, Alas-1 antikoerper, Alas-h antikoerper, ALAS-H antikoerper, ALASN antikoerper, ALAS1 antikoerper, wu:fb58d01 antikoerper, wu:fi12g09 antikoerper, 5'-aminolevulinate synthase 1 antikoerper, aminolevulinic acid synthase 1 antikoerper, alanyl-tRNA synthetase protein antikoerper, aminolevulinate, delta-, synthase 1 antikoerper, ALAS1 antikoerper, Alas1 antikoerper, alas1 antikoerper, alas1.S antikoerper, alaS1 antikoerper

Hintergrund: Delta-aminolevulinate synthase (ALAS, EC 2.3.1.37) catalyzes the condensation of glycine with succinyl-CoA to form delta-aminolevulinic acid. This nuclear-encoded mitochondrial enzyme is the first and rate-limiting enzyme in the mammalian heme biosynthetic pathway. There are 2 tissue-specific isozymes: a housekeeping enzyme encoded by the ALAS1 gene and an erythroid tissue-specific enzyme encoded by ALAS2.

Molekulargewicht: 70 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha