MRPL48 Antikörper (Middle Region)
-
- Target Alle MRPL48 Antikörper anzeigen
- MRPL48 (Mitochondrial Ribosomal Protein L48 (MRPL48))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MRPL48 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MRPL48 antibody was raised against the middle region of MRPL48
- Aufreinigung
- Affinity purified
- Immunogen
- MRPL48 antibody was raised using the middle region of MRPL48 corresponding to a region with amino acids KKGKVEVRAINLGTDYEYGVLNIHLTAYDMTLAESYAQYVHNLCNSLSIK
- Top Product
- Discover our top product MRPL48 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MRPL48 Blocking Peptide, catalog no. 33R-4469, is also available for use as a blocking control in assays to test for specificity of this MRPL48 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL48 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MRPL48 (Mitochondrial Ribosomal Protein L48 (MRPL48))
- Andere Bezeichnung
- MRPL48 (MRPL48 Produkte)
- Synonyme
- HSPC290 antikoerper, L48MT antikoerper, MRP-L48 antikoerper, 1810030E20Rik antikoerper, 2610028L11Rik antikoerper, CGI-118 antikoerper, D4Ertd786e antikoerper, mitochondrial ribosomal protein L48 antikoerper, MRPL48 antikoerper, Mrpl48 antikoerper
- Hintergrund
- Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot
- Molekulargewicht
- 24 kDa (MW of target protein)
-