NT5M Antikörper (N-Term)

Produktnummer ABIN631013

Produktdetails anti-NT5M Antikörper

Target: NT5M (5',3'-Nucleotidase, Mitochondrial (NT5M))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NT5M Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NT5 M antibody was raised against the N terminal of NT5

Aufreinigung: Affinity purified

Immunogen: NT5 M antibody was raised using the N terminal of NT5 corresponding to a region with amino acids ALRVLVDMDGVLADFEGGFLRKFRARFPDQPFIALEDRRGFWVSEQYGRL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NT5M Blocking Peptide, catalog no. 33R-1369, is also available for use as a blocking control in assays to test for specificity of this NT5M antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NT0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NT5M

Target: NT5M (5',3'-Nucleotidase, Mitochondrial (NT5M))

Andere Bezeichnung: NT5M (NT5M Produkte)

Synonyme: NT5M antikoerper, dNT-2 antikoerper, dNT2 antikoerper, mdN antikoerper, 2010013E09Rik antikoerper, AI846937 antikoerper, 5',3'-nucleotidase, mitochondrial antikoerper, NT5M antikoerper, Nt5m antikoerper, nt5m antikoerper

Hintergrund: This gene encodes a 5' nucleotidase that localizes to the mitochondrial matrix. This enzyme dephosphorylates the 5'- and 2'(3')-phosphates of uracil and thymine deoxyribonucleotides. The gene is located within the Smith-Magenis syndrome region on chromosome 17.

Molekulargewicht: 23 kDa (MW of target protein)