LACTB Antikörper (C-Term)
-
- Target Alle LACTB Antikörper anzeigen
- LACTB (Lactamase, beta (LACTB))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LACTB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Beta Lactamase antibody was raised against the C terminal of LACTB
- Aufreinigung
- Affinity purified
- Immunogen
- Beta Lactamase antibody was raised using the C terminal of LACTB corresponding to a region with amino acids TEMSWDKEGKYAMAWGVVERKQTYGSCRKQRHYASHTGGAVGASSVLLVL
- Top Product
- Discover our top product LACTB Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Beta Lactamase Blocking Peptide, catalog no. 33R-9050, is also available for use as a blocking control in assays to test for specificity of this Beta Lactamase antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LACTB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LACTB (Lactamase, beta (LACTB))
- Andere Bezeichnung
- beta Lactamase (LACTB Produkte)
- Hintergrund
- LACTB belongs to the peptidase S12 family. LACTB is a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). It has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.
- Molekulargewicht
- 61 kDa (MW of target protein)
-