LACTB Antikörper (C-Term)

Produktnummer ABIN631015

Produktdetails anti-LACTB Antikörper

Target: LACTB (Lactamase, beta (LACTB))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LACTB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Beta Lactamase antibody was raised against the C terminal of LACTB

Aufreinigung: Affinity purified

Immunogen: Beta Lactamase antibody was raised using the C terminal of LACTB corresponding to a region with amino acids TEMSWDKEGKYAMAWGVVERKQTYGSCRKQRHYASHTGGAVGASSVLLVL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Beta Lactamase Blocking Peptide, catalog no. 33R-9050, is also available for use as a blocking control in assays to test for specificity of this Beta Lactamase antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LACTB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LACTB

Target: LACTB (Lactamase, beta (LACTB))

Andere Bezeichnung: beta Lactamase (LACTB Produkte)

Synonyme: BA2507 antikoerper, PSPTO2834 antikoerper, PSPTO3594 antikoerper, G24 antikoerper, MRPL56 antikoerper, LACT-1 antikoerper, Lact1 antikoerper, Mrpl56 antikoerper, zgc:110419 antikoerper, beta-lactamase antikoerper, class C beta-lactamase AmpC antikoerper, metal-dependent hydrolase antikoerper, lactamase beta antikoerper, Beta-lactamase antikoerper, lactamase, beta antikoerper, metallo-beta-lactamase domain containing 2 antikoerper, Beta lactamase antikoerper, bla1 antikoerper, ampC antikoerper, PSPTO_2834 antikoerper, GSU1378 antikoerper, MCA2220 antikoerper, CJE0344 antikoerper, LACTB antikoerper, Rmar_1357 antikoerper, MGYG_07395 antikoerper, ML5_3452 antikoerper, bla antikoerper, Lactb antikoerper, lactb antikoerper, MBLAC2 antikoerper, blaKPC-2 antikoerper

Hintergrund: LACTB belongs to the peptidase S12 family. LACTB is a protein from the large 39S subunit of the mitochondrial ribosome (mitoribosome). It has some sequence similarity to prokaryotic beta-lactamases but most of the residues that are responsible for the beta-lactamase activity are not conserved between the two proteins.

Molekulargewicht: 61 kDa (MW of target protein)