RPS3A Antikörper (N-Term)

Produktnummer ABIN631017

Produktdetails anti-RPS3A Antikörper

Target: RPS3A (Ribosomal Protein S3A (RPS3A))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPS3A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPS3 A antibody was raised against the N terminal of RPS3

Aufreinigung: Affinity purified

Immunogen: RPS3 A antibody was raised using the N terminal of RPS3 corresponding to a region with amino acids APAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPS3A Blocking Peptide, catalog no. 33R-1414, is also available for use as a blocking control in assays to test for specificity of this RPS3A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPS3A

Target: RPS3A (Ribosomal Protein S3A (RPS3A))

Andere Bezeichnung: RPS3A (RPS3A Produkte)

Synonyme: FTE1 antikoerper, MFTL antikoerper, S3A antikoerper, Rps3a antikoerper, RPS3AE antikoerper, fb02h01 antikoerper, rpS3Ae antikoerper, wu:fb02h01 antikoerper, zgc:73195 antikoerper, zgc:86672 antikoerper, fte1 antikoerper, mftl antikoerper, rps3a antikoerper, C3 antikoerper, CG2168 antikoerper, Dmel\\CG2168 antikoerper, M(4)101 antikoerper, M(4)57g antikoerper, M(4)[57g] antikoerper, M57g antikoerper, M[57g] antikoerper, RPS3A antikoerper, RPS3a antikoerper, RpS3a antikoerper, anon-EST:Liang-2.29 antikoerper, clone 2.29 antikoerper, l(4)102ABa antikoerper, fte-1 antikoerper, ribosomal protein S3A antikoerper, ribosomal protein S3A1 antikoerper, ribosomal protein S3a antikoerper, ribosomal protein S3A L homeolog antikoerper, ribosomal protein S3A S homeolog antikoerper, Ribosomal protein S3A antikoerper, 40S ribosomal protein S3a antikoerper, 40S ribosomal protein S3A antikoerper, RPS3A antikoerper, Rps3a1 antikoerper, Rps3a antikoerper, rps3a antikoerper, rps3a.L antikoerper, rps3a.S antikoerper, RpS3A antikoerper, rs3a antikoerper, KRP-A antikoerper

Hintergrund: RPS3A may play a role during erythropoiesis through regulation of transcription factor DDIT3.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molekulargewicht: 30 kDa (MW of target protein)