RPS3A Antikörper (N-Term)

Produktnummer ABIN631017

Produktdetails anti-RPS3A Antikörper

Target: RPS3A (Ribosomal Protein S3A (RPS3A))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RPS3A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RPS3 A antibody was raised against the N terminal of RPS3

Aufreinigung: Affinity purified

Immunogen: RPS3 A antibody was raised using the N terminal of RPS3 corresponding to a region with amino acids APAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RPS3A Blocking Peptide, catalog no. 33R-1414, is also available for use as a blocking control in assays to test for specificity of this RPS3A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RPS3A

Target: RPS3A (Ribosomal Protein S3A (RPS3A))

Andere Bezeichnung: RPS3A (RPS3A Produkte)

Hintergrund: RPS3A may play a role during erythropoiesis through regulation of transcription factor DDIT3.Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins.

Molekulargewicht: 30 kDa (MW of target protein)