WARS Antikörper (N-Term)
-
- Target Alle WARS Antikörper anzeigen
- WARS (Tryptophanyl-tRNA Synthetase (WARS))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser WARS Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- WARS antibody was raised against the N terminal of WARS
- Aufreinigung
- Affinity purified
- Immunogen
- WARS antibody was raised using the N terminal of WARS corresponding to a region with amino acids EIDSAVKMLVSLKMSYKAAAGEDYKADCPPGNPAPTSNHGPDATEAEEDF
- Top Product
- Discover our top product WARS Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
WARS Blocking Peptide, catalog no. 33R-2465, is also available for use as a blocking control in assays to test for specificity of this WARS antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WARS antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WARS (Tryptophanyl-tRNA Synthetase (WARS))
- Andere Bezeichnung
- WARS (WARS Produkte)
- Synonyme
- GAMMA-2 antikoerper, IFI53 antikoerper, IFP53 antikoerper, zgc:73274 antikoerper, wars antikoerper, MGC53671 antikoerper, WARS antikoerper, TrpRS antikoerper, WRS antikoerper, 85D-WRS antikoerper, CG9735 antikoerper, Dmel\\CG9735 antikoerper, WRS-85D antikoerper, l(3)03559 antikoerper, l(3)03560 antikoerper, l(3)3559 antikoerper, gamma-2 antikoerper, ifi53 antikoerper, ifp53 antikoerper, GB14934 antikoerper, ECK3371 antikoerper, JW3347 antikoerper, tryptophanyl-tRNA synthetase antikoerper, tryptophanyl-tRNA synthetase S homeolog antikoerper, Tryptophanyl-tRNA synthetase antikoerper, tryptophanyl-tRNA synthetase L homeolog antikoerper, tryptophan--tRNA ligase, cytoplasmic antikoerper, WARS antikoerper, wars antikoerper, wars.S antikoerper, Wars antikoerper, TrpRS antikoerper, wars.L antikoerper, LOC727582 antikoerper, trpS antikoerper, trpS2 antikoerper
- Hintergrund
- Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Two forms of tryptophanyl-tRNA synthetase exist, a cytoplasmic form, named WARS, and a mitochondrial form, named WARS2. Tryptophanyl-tRNA synthetase (WARS) catalyzes the aminoacylation of tRNA(trp) with tryptophan and is induced by interferon. Tryptophanyl-tRNA synthetase belongs to the class I tRNA synthetase family.
- Molekulargewicht
- 52 kDa (MW of target protein)
-