DLD Antikörper (Middle Region)
-
- Target Alle DLD Antikörper anzeigen
- DLD (Dihydrolipoamide Dehydrogenase (DLD))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DLD Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DLD antibody was raised against the middle region of DLD
- Aufreinigung
- Affinity purified
- Immunogen
- DLD antibody was raised using the middle region of DLD corresponding to a region with amino acids AGEMVNEAALALEYGASCEDIARVCHAHPTLSEAFREANLAASFGKSINF
- Top Product
- Discover our top product DLD Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DLD Blocking Peptide, catalog no. 33R-1194, is also available for use as a blocking control in assays to test for specificity of this DLD antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLD antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DLD (Dihydrolipoamide Dehydrogenase (DLD))
- Andere Bezeichnung
- DLD (DLD Produkte)
- Synonyme
- DLDD antikoerper, DLDH antikoerper, E3 antikoerper, GCSL antikoerper, LAD antikoerper, PHE3 antikoerper, AI315664 antikoerper, AI746344 antikoerper, wu:fb24b05 antikoerper, DLD antikoerper, DDBDRAFT_0183800 antikoerper, DDBDRAFT_0216232 antikoerper, DDB_0183800 antikoerper, DDB_0216232 antikoerper, sc:d0402 antikoerper, dihydrolipoamide dehydrogenase antikoerper, dihydrolipoyl dehydrogenase antikoerper, deltaD antikoerper, DLD antikoerper, Dld antikoerper, dldh antikoerper, AT4G16155 antikoerper, CND05840 antikoerper, bfmBC antikoerper, GCSL antikoerper, LACBIDRAFT_182385 antikoerper, UREG_06178 antikoerper, lpd antikoerper, TAGG_RS02070 antikoerper, Arnit_2606 antikoerper, Mesil_1945 antikoerper, Trad_2118 antikoerper, Acear_0640 antikoerper, Fbal_0372 antikoerper, Ilyop_1890 antikoerper, Ftrac_1733 antikoerper, Ocepr_1753 antikoerper, Intca_2017 antikoerper, Deima_0504 antikoerper, dld antikoerper
- Hintergrund
- DLD is the L protein of the mitochondrial glycine cleavage system. The L protein, also named dihydrolipoamide dehydrogenase, is also a component of the pyruvate dehydrogenase complex, the alpha-ketoglutarate dehydrogenase complex, and the branched-chain alpha-keto acide dehydrogenase complex. Mutations in this gene have been identified in patients with E3-deficient maple syrup urine disease and lipoamide dehydrogenase deficiency.
- Molekulargewicht
- 56 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process, Cell RedoxHomeostasis
-