ETFB Antikörper (C-Term)
-
- Target Alle ETFB Antikörper anzeigen
- ETFB (Electron-Transfer-Flavoprotein, beta Polypeptide (ETFB))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ETFB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ETFB antibody was raised against the C terminal of ETFB
- Aufreinigung
- Affinity purified
- Immunogen
- ETFB antibody was raised using the C terminal of ETFB corresponding to a region with amino acids TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP
- Top Product
- Discover our top product ETFB Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ETFB Blocking Peptide, catalog no. 33R-8967, is also available for use as a blocking control in assays to test for specificity of this ETFB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ETFB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ETFB (Electron-Transfer-Flavoprotein, beta Polypeptide (ETFB))
- Andere Bezeichnung
- ETFB (ETFB Produkte)
- Hintergrund
- ETFB is the electron-transfer-flavoprotein, beta polypeptide, which shuttles electrons between primary flavoprotein dehydrogenases involved in mitochondrial fatty acid and amino acid catabolism and the membrane-bound electron transfer flavoprotein ubiquinone oxidoreductase. The gene deficiencies have been implicated in type II glutaricaciduria.
- Molekulargewicht
- 28 kDa (MW of target protein)
-