TRMU Antikörper (C-Term)
-
- Target Alle TRMU Antikörper anzeigen
- TRMU (tRNA 5-Methylaminomethyl-2-Thiouridylate Methyltransferase (TRMU))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TRMU Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TRMU antibody was raised against the C terminal of TRMU
- Aufreinigung
- Affinity purified
- Immunogen
- TRMU antibody was raised using the C terminal of TRMU corresponding to a region with amino acids ALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSP
- Top Product
- Discover our top product TRMU Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TRMU Blocking Peptide, catalog no. 33R-1321, is also available for use as a blocking control in assays to test for specificity of this TRMU antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRMU antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRMU (tRNA 5-Methylaminomethyl-2-Thiouridylate Methyltransferase (TRMU))
- Andere Bezeichnung
- TRMU (TRMU Produkte)
- Hintergrund
- TRMU is a member of the trmU family. It is a mitochondria-specific tRNA-modifying enzyme that is required for the 2-thio modification of 5-taurinomethyl-2-thiouridine tRNA-Lys on the wobble position of the anticodon.
- Molekulargewicht
- 48 kDa (MW of target protein)
-