GLYAT Antikörper (N-Term)
-
- Target Alle GLYAT Antikörper anzeigen
- GLYAT (Glycine N-Acyltransferase (GLYAT))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GLYAT Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- GLYAT antibody was raised against the N terminal of GLYAT
- Aufreinigung
- Affinity purified
- Immunogen
- GLYAT antibody was raised using the N terminal of GLYAT corresponding to a region with amino acids HYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAA
- Top Product
- Discover our top product GLYAT Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GLYAT Blocking Peptide, catalog no. 33R-3880, is also available for use as a blocking control in assays to test for specificity of this GLYAT antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLYAT antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GLYAT (Glycine N-Acyltransferase (GLYAT))
- Andere Bezeichnung
- GLYAT (GLYAT Produkte)
- Hintergrund
- The glycine-N-acyltransferase protein conjugates glycine with acyl-CoA substrates in the mitochondria. The protein is thought to be important in the detoxification of endogenous and xenobiotic acyl-CoA's.
- Molekulargewicht
- 34 kDa (MW of target protein)
-