AIFM3 Antikörper (Middle Region)
-
- Target Alle AIFM3 Antikörper anzeigen
- AIFM3 (Apoptosis-Inducing Factor, Mitochondrion-Associated, 3 (AIFM3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AIFM3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- AIFM3 antibody was raised against the middle region of AIFM3
- Aufreinigung
- Affinity purified
- Immunogen
- AIFM3 antibody was raised using the middle region of AIFM3 corresponding to a region with amino acids EGFSDRIVLCTLDRHLPYDRPKLSKSLDTQPEQLALRPKEFFRAYGIEVL
- Top Product
- Discover our top product AIFM3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
AIFM3 Blocking Peptide, catalog no. 33R-2429, is also available for use as a blocking control in assays to test for specificity of this AIFM3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AIFM3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- AIFM3 (Apoptosis-Inducing Factor, Mitochondrion-Associated, 3 (AIFM3))
- Andere Bezeichnung
- AIFM3 (AIFM3 Produkte)
- Synonyme
- nfrl-A antikoerper, MGC84340 antikoerper, AIFM3 antikoerper, LOC100150876 antikoerper, 2810401C16Rik antikoerper, AI840249 antikoerper, Aifl antikoerper, RGD1306028 antikoerper, AIFL antikoerper, apoptosis inducing factor, mitochondria associated 3 L homeolog antikoerper, apoptosis inducing factor, mitochondria associated 3 antikoerper, apoptosis-inducing factor, mitochondrion-associated 3 antikoerper, aifm3.L antikoerper, AIFM3 antikoerper, aifm3 antikoerper, Aifm3 antikoerper
- Hintergrund
- AIFM3 induces apoptosis through a caspase dependent pathway. AIFM3 reduces mitochondrial membrane potential.
- Molekulargewicht
- 67 kDa (MW of target protein)
- Pathways
- Positive Regulation of Endopeptidase Activity, Cell RedoxHomeostasis
-