ISCA2 Antikörper

Produktnummer ABIN631044

Produktdetails anti-ISCA2 Antikörper

Target: ISCA2 (Iron-Sulfur Cluster Assembly 2 Homolog (ISCA2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ISCA2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: ISCA2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ISCA2 Blocking Peptide, catalog no. 33R-8133, is also available for use as a blocking control in assays to test for specificity of this ISCA2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ISCA2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ISCA2

Target: ISCA2 (Iron-Sulfur Cluster Assembly 2 Homolog (ISCA2))

Andere Bezeichnung: ISCA2 (ISCA2 Produkte)

Synonyme: HBLD1 antikoerper, ISA2 antikoerper, c14_5557 antikoerper, Hbld1 antikoerper, RGD1563216 antikoerper, 0710001C05Rik antikoerper, 5730594E03Rik antikoerper, iron-sulfur cluster assembly 2 antikoerper, ISCA2 antikoerper, Isca2 antikoerper

Hintergrund: ISCA2 is involved in the assembly of mitochondrial iron-sulfur proteins. Probably involved in the binding of an intermediate of Fe/S cluster assembly.

Molekulargewicht: 16 kDa (MW of target protein)