MPP5 Antikörper
-
- Target Alle MPP5 Antikörper anzeigen
- MPP5 (Membrane Protein, Palmitoylated 5 (MAGUK P55 Subfamily Member 5) (MPP5))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MPP5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- MPP5 antibody was raised using a synthetic peptide corresponding to a region with amino acids AVDCPGDLGTRMMPIRRSAQLERIRQQQEDMRRRREEEGKKQELDLNSSM
- Top Product
- Discover our top product MPP5 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MPP5 Blocking Peptide, catalog no. 33R-1585, is also available for use as a blocking control in assays to test for specificity of this MPP5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPP5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MPP5 (Membrane Protein, Palmitoylated 5 (MAGUK P55 Subfamily Member 5) (MPP5))
- Andere Bezeichnung
- MPP5 (MPP5 Produkte)
- Synonyme
- PALS1 antikoerper, 3830420B02Rik antikoerper, AI255216 antikoerper, AI644496 antikoerper, Pals1 antikoerper, mpp5 antikoerper, nok antikoerper, MAGUK p55 subfamily member 5 antikoerper, membrane palmitoylated protein 5 antikoerper, membrane protein, palmitoylated 5 L homeolog antikoerper, membrane protein, palmitoylated 5 (MAGUK p55 subfamily member 5) antikoerper, membrane protein, palmitoylated 5a (MAGUK p55 subfamily member 5) antikoerper, Tsp_03061 antikoerper, MPP5 antikoerper, mpp5.L antikoerper, Mpp5 antikoerper, mpp5a antikoerper
- Hintergrund
- Members of the peripheral membrane-associated guanylate kinase (MAGUK) family function in tumor suppression and receptor clustering by forming multiprotein complexes containing distinct sets of transmembrane, cytoskeletal, and cytoplasmic signaling proteins. All MAGUKs contain a PDZ-SH3-GUK core and are divided into 4 subfamilies, DLG-like, ZO1-like, p55-like, and LIN2-like, based on their size and the presence of additional domains. MPP5 is a member of the p55-like MAGUK subfamily.
- Molekulargewicht
- 77 kDa (MW of target protein)
- Pathways
- Nucleotide Phosphorylation, Tube Formation, Asymmetric Protein Localization
-