LRP1 Antikörper
-
- Target Alle LRP1 Antikörper anzeigen
- LRP1 (Low Density Lipoprotein Receptor-Related Protein 1 (LRP1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LRP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- LRP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ATYLSGAQVSTITPTSTRQTTAMDFSYANETVCWVHVGDSAAQTQLKCAR
- Top Product
- Discover our top product LRP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LRP1 Blocking Peptide, catalog no. 33R-1577, is also available for use as a blocking control in assays to test for specificity of this LRP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRP1 (Low Density Lipoprotein Receptor-Related Protein 1 (LRP1))
- Andere Bezeichnung
- LRP1 (LRP1 Produkte)
- Synonyme
- A2MR antikoerper, APOER antikoerper, APR antikoerper, CD91 antikoerper, IGFBP3R antikoerper, LRP antikoerper, LRP1A antikoerper, TGFBR5 antikoerper, A2mr antikoerper, AI316852 antikoerper, Lrp antikoerper, LRP-1 antikoerper, LDL receptor related protein 1 antikoerper, prolow-density lipoprotein receptor-related protein 1 antikoerper, low density lipoprotein receptor-related protein 1 antikoerper, LRP1 antikoerper, Lrp1 antikoerper, LOC100414789 antikoerper
- Hintergrund
- Low-density lipoprotein receptor-related protein 1 (-2-macroglobulin receptor, LRP1) is a multifunctional endocytic receptor with an important role in regulating the activity of proteinases in the extracellular matrix. It is also involved in intracellular signaling and the subcellular translocation of preassembled signaling complexes from the plasma membrane.
- Molekulargewicht
- 48 kDa (MW of target protein)
- Pathways
- Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling
-