ALAS2 Antikörper (N-Term)

Produktnummer ABIN631054

Produktdetails anti-ALAS2 Antikörper

Target: ALAS2 (Aminolevulinate, delta-, Synthase 2 (ALAS2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALAS2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ALAS2 antibody was raised against the N terminal of ALAS2

Aufreinigung: Affinity purified

Immunogen: ALAS2 antibody was raised using the N terminal of ALAS2 corresponding to a region with amino acids CPILATQGPNCSQIHLKATKAGGDSPSWAKGHCPFMLSELQDGKSKIVQK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALAS2 Blocking Peptide, catalog no. 33R-1765, is also available for use as a blocking control in assays to test for specificity of this ALAS2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALAS2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALAS2

Target: ALAS2 (Aminolevulinate, delta-, Synthase 2 (ALAS2))

Andere Bezeichnung: ALAS2 (ALAS2 Produkte)

Synonyme: anh1 antikoerper, asb antikoerper, xlsa antikoerper, ALAS-E antikoerper, ALASE antikoerper, ANH1 antikoerper, ASB antikoerper, XLDPP antikoerper, XLEPP antikoerper, XLSA antikoerper, alas-e antikoerper, cb1063 antikoerper, sau antikoerper, sauternes antikoerper, ALAS antikoerper, Alas-2 antikoerper, 5'-aminolevulinate synthase 2 antikoerper, aminolevulinate, delta-, synthase 2 antikoerper, aminolevulinic acid synthase 2, erythroid antikoerper, alas2 antikoerper, ALAS2 antikoerper, Alas2 antikoerper, alas2.L antikoerper

Hintergrund: ALAS2 specifies an erythroid-specific mitochondrially located enzyme. The protein catalyzes the first step in the heme biosynthetic pathway. Defects in its gene cause X-linked pyridoxine-responsive sideroblastic anemia. Alternatively spliced transcript variants encoding different isoforms have been identified.

Molekulargewicht: 60 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis