VPS28 Antikörper
-
- Target Alle VPS28 Antikörper anzeigen
- VPS28 (Vacuolar Protein Sorting 28 (VPS28))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser VPS28 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- VPS28 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQ
- Top Product
- Discover our top product VPS28 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
VPS28 Blocking Peptide, catalog no. 33R-5993, is also available for use as a blocking control in assays to test for specificity of this VPS28 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VPS28 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- VPS28 (Vacuolar Protein Sorting 28 (VPS28))
- Andere Bezeichnung
- VPS28 (VPS28 Produkte)
- Synonyme
- CG12770 antikoerper, DmVps28 antikoerper, Dmel\\CG12770 antikoerper, Dvps28 antikoerper, ESCRT-I antikoerper, ESCRT-II antikoerper, dVps28 antikoerper, dvps28 antikoerper, l(2)k16503 antikoerper, vps28 antikoerper, VPS28 antikoerper, GB12925 antikoerper, VPL13 antikoerper, VPT28 antikoerper, DDBDRAFT_0186436 antikoerper, DDBDRAFT_0234023 antikoerper, DDB_0186436 antikoerper, DDB_0234023 antikoerper, 1110014J03Rik antikoerper, AI847241 antikoerper, D730005C08Rik antikoerper, zgc:66078 antikoerper, Vacuolar protein sorting 28 antikoerper, VPS28, ESCRT-I subunit antikoerper, vacuolar protein sorting 28 homolog antikoerper, vacuolar protein sorting-associated protein 28 homolog antikoerper, ESCRT-I subunit protein VPS28 antikoerper, ESCRT I complex subunit Vps28 antikoerper, transport of soluble vacuolar hydrolase precursors antikoerper, subunit of the ESCRT-I complex antikoerper, vacuolar protein sorting-associated protein antikoerper, vacuolar protein sorting 28 family protein antikoerper, vacuolar protein sorting-associated protein 28 antikoerper, Vacuolar protein sorting-associated protein 28 homolog antikoerper, vacuolar protein sorting 28 antikoerper, vacuolar protein sorting 28 (yeast) antikoerper, vacuolar protein sorting 28 homolog S homeolog antikoerper, Vps28 antikoerper, VPS28 antikoerper, vps28 antikoerper, LOC408783 antikoerper, CpipJ_CPIJ003920 antikoerper, LACBIDRAFT_399656 antikoerper, PTRG_04781 antikoerper, MCYG_00028 antikoerper, PITG_04534 antikoerper, Tsp_08691 antikoerper, Tsp_08687 antikoerper, Tsp_08688 antikoerper, vps-28 antikoerper, vps28.S antikoerper
- Hintergrund
- This gene encodes a protein involved in endosomal sorting of cell surface receptors via a multivesicular body/late endosome pathway.
- Molekulargewicht
- 25 kDa (MW of target protein)
-